Everything below concerns LC-MS/MS. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-02-27. Numbers and descriptions here follow the published literature rather than marketing material.
SR9009 is a synthetic small molecule studied as a REV-ERB agonist. REV-ERBα and REV-ERBβ are nuclear receptors that help regulate circadian rhythms and metabolic gene expression. The compound was identified in academic screening efforts to find synthetic ligands for these receptors. In cell and animal studies, SR9009 alters transcription of genes involved in lipid and glucose metabolism, and it can shift circadian behavior. It is not an approved therapeutic agent.
Mechanistically, SR9009 binds the ligand-binding domain of REV-ERBα/β and enhances recruitment of corepressor complexes. This represses target genes rather than activating them. Because REV-ERB proteins normally compete with ROR proteins at shared response elements, the net effect depends on tissue and timing. Researchers use SR9009 to probe how nuclear receptor signaling links the clock to metabolism, inflammation, and muscle biology. Findings are largely preclinical, and the precise contribution of each receptor subtype remains under study.
Analytical identification and purity assessment often use high-performance liquid chromatography with ultraviolet detection or mass spectrometry. Liquid chromatography–tandem mass spectrometry is used to detect and quantify SR9009 in biological matrices, including urine and blood, for anti-doping or pharmacokinetic studies. Nuclear magnetic resonance spectroscopy can confirm molecular structure. Stability depends on form and storage: the solid is generally more stable than solutions, and repeated freeze–thaw cycles may degrade samples. Purity is typically reported as a percentage from a certificate of analysis.
Regulatory treatment of SR9009 varies by country and context. It is not approved as a therapeutic drug by agencies such as the United States Food and Drug Administration or the European Medicines Agency. Sports authorities list it as a prohibited substance; the World Anti-Doping Agency classifies it among hormone and metabolic modulators. Legal status for personal possession or sale differs across jurisdictions, and some countries may restrict it under analog or research chemical laws. Buyers who seek verified material often rely on independent laboratory testing because online product labels may not match contents.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic REV-ERB agonist | Small-molecule ligand; not a hormone or peptide |
| Molecular formula | C20H24ClN3O4S | Reported for the free base |
| CAS Registry Number | 1379686-30-2 | Unique chemical identifier |
| Common synonyms | SR9009; stenabolic | Stenabolic is informal and not an official name |
| Reported targets | REV-ERBα and REV-ERBβ | Nuclear receptors linked to circadian and metabolic regulation |
Quality control for research materials includes identity confirmation by nuclear magnetic resonance and purity assessment by high-performance liquid chromatography. Mass spectrometry provides molecular weight confirmation and can detect related impurities. Purchasers should request a certificate of analysis that lists lot-specific data. Online products advertised for human use often lack such documentation. Distinguishing legitimate research material from mislabeled or contaminated samples is a recurring challenge in independent testing, and independent laboratories may use orthogonal methods to verify identity.
Detection of SR9009 in biological samples usually relies on liquid chromatography coupled to tandem mass spectrometry. This approach separates the compound from matrix components and identifies it by mass transitions. Because SR9009 can undergo metabolism, laboratories often look for both parent drug and specific metabolites. Sample preparation may involve protein precipitation or solid-phase extraction. Method validation examines sensitivity, carryover, and interference from related substances, and reference standards are required for accurate calibration.
Storage recommendations for SR9009 reference material typically specify a freezer at -20 °C or lower, with protection from moisture and light. Repeated freeze-thaw cycles can degrade small molecules and introduce variability. Stock solutions in dimethyl sulfoxide are often aliquoted to avoid repeated handling. Stability studies may examine degradation under heat, humidity, and light exposure. The compound's thiophene and nitro groups can participate in reactions that alter analytical signals over time, so such changes affect quantitative results.
== Legal status == Coca tea is legal in Colombia, Peru, Bolivia, Argentina, Uruguay and Ecuador. Its use is being discouraged in part by the Single Convention on Narcotic Drugs. Coca tea is illegal in the United States unless it is decocainized.
In the late 20th and early 21st centuries, fishing off the European and American coasts severely depleted stocks and become a major political issue. The necessity of restricting catches to allow stocks to recover upset the fishing industry and politicians who are reluctant to hurt employment.
yr) by detecting the 39K→38Ar→37Ar decay chain. Above the electroweak scale ΛEW (corresponding to the vacuum expectation value of the Higgs field, around 246 GeV), where Standard Model unification occurs, the three fundamental forces have comparable couplings, suggesting unification in Grand Unified Theories (GUTs). Historical models like Pati–Salam model (1973), unifying quarks/leptons and Georgi–Glashow model (1974), unifying all forces and particles/antiparticles, predict B violation via superheavy gauge bosons MX. The natural GUT energy scale ΛGUT is where SM gauge couplings converge, ~1015 GeV. This value is approximately thirteen orders of magnitude higher than the electroweak scale, or more than eleven orders of magnitude higher than the energy achievable in experiments conducted at particle accelerators. However, at these energies the estimation of proton decay lifetime is around 1029–1031 yr, within reach of dedicated experiments: when GUTs were proposed, the experimental limits were around 1030 yr (for decay modes which produce 𝜇 →𝑒 decays). These considerations strongly motivated proton decay searches. In 1981 was published the first limit by a water Cherenkov detector at the Homestake gold mine, looking for the production and detection of a decaying muon following a nucleon decay event:
== Types == Fetuin-A was the first hepatokine to be described and correlated with increased inflammation and insulin resistance. Fetuin-B significantly increases hepatic steatosis and mediates impaired insulin action and glucose intolerance. ANGPTL8/betatrophin, initially proposed for its action on beta cell proliferation, although this effect has recently been brought into question. FGF-21 an insulin-sensitising hormone that is an appealing drug target because of its beneficial metabolic actions. Adropin is linked to macronutrient intake and estrogen. ANGPTL4 can inhibit lipoprotein lipase and activate cAMP-stimulated lipolysis in adipocytes.
Sources: en.wikipedia.org
=== DAPI === DAPI is a fluorescent nuclear stain, excited by ultraviolet light and showing strong blue fluorescence when bound to DNA. DAPI binds with A=T rich repeats of chromosomes. DAPI is also not visible with regular transmission microscopy. It may be used in living or fixed cells. DAPI-stained cells are especially appropriate for cell counting.
=== Effective altruism === Effective accelerationism diverges from the principles of effective altruism, which prioritizes using evidence and reasoning to identify the most effective ways to altruistically improve the world. This divergence comes primarily from one of the causes effective altruists focus on – AI existential risk. Effective altruists (particularly longtermists) argue that AI companies should be cautious and strive to develop safe AI systems, as they fear that any misaligned AGI could eventually lead to human extinction. Proponents of effective accelerationism generally consider existential risks from AGI to be negligible, and claim that even if they were not, decentralized free markets would much better mitigate this risk than centralized governmental regulation.
The British government dismissed this option because of various logistical issues, the risk of provoking a Rhodesian attack on Zambia and the psychological problems that were likely to accompany any confrontation between British and Rhodesian troops in what Smith said would be a "fratricidal war". British Foreign Secretary Michael Stewart stated that the United Kingdom thought that Rhodesian forces were well-equipped, well-trained and highly motivated and that an invasion would lead to "a medium sized war of uncertain duration". Wilson instead resolved to end the Rhodesian rebellion through economic sanctions; these principally comprised the expulsion of Rhodesia from the Sterling area, a ban on the import of Rhodesian sugar, tobacco, chrome and other goods and an oil boycott of Rhodesia. When the Rhodesians continued to receive oil, Wilson attempted to directly cut off their main supply lines, namely the Portuguese Mozambican ports at Beira and Lourenço Marques, by posting a Royal Navy squadron to the Mozambique Channel in March 1966. This blockade, the Beira Patrol, was endorsed the following month by UN Security Council Resolution 221. The United Nations proceeded to institute the first mandatory trade sanctions in its history with Security Council Resolutions 232 (December 1966) and 253 (April 1968), which required member states to cease all trade and economic links with Rhodesia.
Human physiology is the study of how the human body functions. This includes the mechanical, physical, bioelectrical, and biochemical functions of humans in good health, from organs to the cells of which they are composed. The human body consists of many interacting systems of organs. These interact to maintain homeostasis, keeping the body in a stable state with safe levels of substances such as sugar and oxygen in the blood. Each system contributes to homeostasis, of itself, other systems, and the entire body. Some combined systems are referred to by joint names. For example, the nervous system and the endocrine system operate together as the neuroendocrine system. The nervous system receives information from the body, and transmits this to the brain via nerve impulses and neurotransmitters. At the same time, the endocrine system releases hormones, such as to help regulate blood pressure and volume. Together, these systems regulate the internal environment of the body, maintaining blood flow, posture, energy supply, temperature, and acid balance (pH).
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Sources: en.wikipedia.org
SR9009 is a synthetic compound investigated as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is used in preclinical research on circadian rhythm and metabolism. It is not an approved drug.
No. It has no approved medical indication, and human safety and efficacy data are limited. It appears in research chemical markets and is banned by some sports authorities.
Natural ligands include heme and certain metabolites; SR9009 is a synthetic small molecule with higher potency and selectivity in some assays. Its effects depend on cell type and timing. It is not a naturally occurring compound.
Legality depends on the country and the intended use. In many places it is sold as a research chemical, but sports and medicine regulations restrict it.