reference standard is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-05-19. Where a claim depends on a specific study, the study is described rather than over-claimed.
Pharmacokinetic data for SR9009 are limited in published literature. Some reports indicate low oral bioavailability and rapid clearance in animals, which complicates interpretation of exposure and effect. Researchers often use injected routes in preclinical work to achieve measurable systemic levels. Analytical studies rely on mass spectrometry to detect the parent compound and its metabolites. Questions about tissue distribution, active metabolites, and long-term consequences remain open. Species differences in metabolism can affect observed half-life and target engagement.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. These receptors help regulate circadian rhythms and metabolic gene expression. In laboratory experiments, SR9009 binds these receptors and alters transcription of genes involved in lipid handling, glucose metabolism, and mitochondrial function. It is not a naturally occurring compound and has no approved therapeutic use. Research interest stems from its ability to modify energy metabolism in cells and animal models.
In rodent studies, SR9009 has been reported to increase mitochondrial content in skeletal muscle and improve exercise endurance under some conditions. These findings led to popular descriptions such as an exercise mimetic, although that term oversimplifies the biology. Effects vary by dose, timing, tissue, and model. The compound's influence on circadian pathways means that time of administration can matter in experiments. Whether similar metabolic changes occur in humans remains largely unexplored in controlled published trials.
Most published work on SR9009 consists of preclinical studies. It is widely sold as a research chemical, a category that does not imply safety, efficacy, or pharmaceutical-grade quality. Sports anti-doping organizations have listed SR9009 as a prohibited substance, and its presence in an athlete sample can lead to sanctions. Legal status differs by country; in several jurisdictions it is not approved for human consumption and may be treated as an unapproved new drug.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not a steroid, peptide, or natural hormone. In scientific literature, it appears under the code SR9009 and in non-scientific contexts as Stenabolic. The compound was identified through chemical screening efforts aimed at targeting circadian clock components. Its status remains investigational, and no regulatory agency has approved it as a human medicine.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic small-molecule REV-ERB agonist | Not a hormone or natural product |
| Primary targets | REV-ERBα and REV-ERBβ | Nuclear receptors involved in circadian and metabolic regulation |
| Appearance | White to off-white solid | Typical for purified research samples |
| Solubility | Soluble in DMSO and ethanol; low water solubility | Laboratory solubility depends on solvent and purity |
| Common synonyms | SR9009; Stenabolic | Stenabolic is a colloquial name, not a formal chemical name |
Identity and purity testing for SR9009 commonly uses liquid chromatography coupled with tandem mass spectrometry. This method separates the compound from matrix components and detects it by mass-to-charge transitions, providing sensitive and specific confirmation. Nuclear magnetic resonance spectroscopy can support structural identification, while high-performance liquid chromatography with ultraviolet detection may estimate purity. Because online products labeled as SR9009 may contain other substances or no active compound at all, independent verification is important in research settings. Certificates of analysis are useful but not a substitute for in-house testing.
Laboratory samples of SR9009 are typically supplied as a white to off-white powder. The compound dissolves readily in organic solvents such as dimethyl sulfoxide and ethanol, while its solubility in water is low. Because of this solubility profile, researchers often prepare concentrated stock solutions in an organic solvent before diluting them into aqueous assay buffers. Light exposure, moisture, and repeated freeze-thaw cycles can degrade many small molecules, so handling procedures usually aim to minimize these factors. Purity is commonly checked before use.
Storage conditions for research-grade SR9009 generally involve a freezer at approximately minus twenty degrees Celsius, sometimes lower for long-term preservation. Containers should remain tightly closed and protected from light. Desiccants may be used to limit moisture uptake. Solutions are often stored in aliquots to avoid repeated warming and cooling. Stability data for the compound under various conditions are limited, so laboratories typically follow supplier recommendations and verify performance through periodic analytical checks rather than assuming indefinite stability.
Physicochemical behavior influences handling. SR9009 is described as a solid with limited aqueous solubility, so organic solvents such as dimethyl sulfoxide or ethanol are common in research stock solutions. Aqueous dilution can produce precipitates if the organic content is too low. Light, heat, and repeated freeze-thaw cycles may affect stability. Storage recommendations usually specify a desiccated freezer environment protected from light, but exact stability data depend on the formulation and matrix.
Detection in biological samples can be complicated by rapid metabolism and low circulating concentrations. Some studies report phase I and phase II metabolites, and analytical methods may need to target those species in addition to the parent compound. Immunoassays are not broadly available, so mass spectrometry remains the main confirmatory approach. For anti-doping testing, laboratories look for SR9009 and its metabolites using validated LC-MS methods. Open questions include how long metabolites remain detectable and how different routes of administration alter detection windows.
In laboratory settings, SR9009 is typically characterized by liquid chromatography–mass spectrometry (LC-MS) or high-performance liquid chromatography with ultraviolet detection (HPLC-UV). These methods can confirm identity and estimate purity, but they require reference standards for accurate quantification. Because SR9009 is not a licensed pharmaceutical, no harmonized pharmacopeial monograph exists. Laboratories often validate in-house methods for matrices such as plasma, urine, or cell culture media. Sample preparation may involve protein precipitation or liquid-liquid extraction before analysis.
=== Discovery biology === The company’s biology division provides assay development, cellular and biochemical assay platforms, pharmacology studies, protein science, and ligand-binding analytics. These capabilities support early-stage target validation, mechanism-of-action studies, and preclinical screening across therapeutic areas commonly explored by biotech companies.
=== Cultivars === P. somniferum has had a very long tradition of use, starting in the Neolithic. This long period of time allowed the development of a broad range of different forms. In total there are 52 botanical varieties. Breeding of P. somniferum faces a challenge caused by the contradictory breeding goals for this species. On one hand a very high content of alkaloids is requested for medical uses. Global demand for the alkaloids and their pharmaceutical derivatives has increased in recent years. Therefore, there is a need for the development of cultivars with a high opium yield. On the other hand, the food industry demands alkaloid contents be as low as possible. There are also many ornamental cultivars selected for colour or number of their petals or other characteristics. There are double-flowered cultivars, often called peony flowered or 'paeoniflorum' in a range of colours. There are even varieties selected for the shape of their pods such as 'Hen and Chickens' with smaller pods around a larger central pod.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
In humans, fatty acids are formed from carbohydrates predominantly in the liver and adipose tissue, as well as in the mammary glands during lactation. The pyruvate produced by glycolysis is an important intermediary in the conversion of carbohydrates into fatty acids and cholesterol. This occurs via the conversion of pyruvate into acetyl-CoA in the mitochondrion. However, this acetyl-CoA needs to be transported into cytosol where the synthesis of fatty acids and cholesterol occurs. This cannot occur directly. To obtain cytosolic acetyl-CoA, citrate (produced by the condensation of acetyl-CoA with oxaloacetate) is removed from the citric acid cycle and carried across the inner mitochondrial membrane into the cytosol. There it is cleaved by ATP citrate lyase into acetyl-CoA and oxaloacetate. The oxaloacetate can be used for gluconeogenesis (in the liver), or it can be returned into mitochondrion as malate. The cytosolic acetyl-CoA is carboxylated by acetyl-CoA carboxylase into malonyl-CoA, the first committed step in the synthesis of fatty acids.
Solvent extraction is used to extract individual lanthanoid elements from the mixtures found in nature in ores such as monazite. In one process, the metal ions in aqueous solution are made to form complexes with tributylphosphate (TBP), which are extracted into an organic solvent such as kerosene. Complete separation is effected by using a countercurrent exchange method. A number of cells are arranged as a cascade. After equilibration, the aqueous component of each cell is transferred to the previous cell and the organic component is transferred to the next cell, which initially contains only water. In this way the metal ion with the most stable complex passes down the cascade in the organic phase and the metal with the least stable complex passes up the cascade in the aqueous phase. If solubility in the organic phase is not an issue, a selectivity coefficient is equal to the ratio of the stability constants of the TBP complexes of two metal ions. For lanthanoid elements which are adjacent in the periodic table this ratio is not much greater than 1, so many cells are needed in the cascade.
Sources: en.wikipedia.org
In May 2007, Unilever became the first company to commit to sourcing all tea in a sustainable manner. Working with the Rainforest Alliance, an international environmental NGO, Unilever, announced all Lipton Yellow Label tea bags sold in Western Europe would be certified by 2010 and all Lipton tea bags sold globally by 2015. Lipton's own tea estates were among the first to be certified. Lipton tea bearing the Rainforest Alliance seal appeared on Western European markets in 2008 and started appearing in North America in 2009. On 6 May 2009, Lipton received a Corporate Green Globe Award for its work with the Rainforest Alliance. In 2011, PETA criticized Unilever for conducting and funding experiments on rabbits, pigs and other animals in an attempt to make human health claims about the tea's ingredients. According to the animal rights organization, Unilever decided to end the practice after receiving more than 40,000 appeals from PETA supporters and days before PETA made plans to launch its "Lipton CruelTEA" campaign. Unilever no longer tests their products on animals unless required to by governments as part of their regulatory requirements. Unilever reached an agreement in November 2021 to sell the majority of its tea business to private equity firm CVC Capital Partners for €4.5 billion. This included the Lipton brand except where Unilever retained its use for tea in India, Nepal, and Indonesia, for ready to drink teas globally, and for soup mixes in North America. The sale was completed in July 2022, with the new company named ‘Lipton Teas and Infusions’.
In 2017, Ice-T signed a petition to Congress for criminal-justice reform. His 1994 book, The Ice Opinion, was largely focused on his view on politics. Writing in the aftermath of the 1992 Los Angeles riots, he was one of the only rappers who criticized the targeting of Koreans by some Black rioters. On June 5, 2008, Ice-T joked that he would be voting for John McCain in the 2008 American elections, speculating that his past affiliation with Body Count could hurt Barack Obama's chances if he endorsed him, so he would choose instead to ruin McCain's campaign by saying he supported him. In 2015, Ice-T said that he admired Obama "just for the simple fact he took the shot and went all the way to be president" and included Obama in the list of people who he would like to have for a dream dinner party. On September 22, 2022, Ice-T narrated an advertisement for the Foundation for Individual Rights and Expression.
Moreover, the Australian High Court is behind international standards by refusing to accept that employment is shaped by unequal bargaining power, or carries a duty of mutual trust and confidence, even a similar duty is accepted for commercial franchising and distribution agreements. In Commonwealth Bank of Australia Ltd v Barker the High Court held there was no duty of mutual trust and confidence because employment is already heavily regulated by statute, which led to their conclusion that fair treatment in redundancy was not implied. By contrast, under the Independent Contractors Act 2006 section 12 explicitly states courts have the power to review and vary independent contractors' contracts if they are unfair, given their unequal bargaining power and lack of other statutory rights. Terms may also be implied by custom 'so well known and acquiesced in that everyone making a contract... can reasonably be presumed to have imported that term into the contract.'
In 1985, Kidder expressed ambivalence toward continuing her career, and was quoted as saying: "I don't feel comfortable as a performer and I'm a big turkey as a movie star." She stated that the quote was reported out of context, but conceded: "I am in a weird frame of mind at the moment. I know acting is not going to be enough for me for the rest of my life. This business is very hard on women at a certain age, and I never want to end up just having to accept what's offered me. So, I am anxious to direct, to have options." In 1986, she was selected as the English narrator for the Japanese animated series The Wonderful Wizard of Oz. In 1987, Kidder reprised her Lois Lane role in Superman IV: The Quest for Peace (1987), which she filmed in 1986. Body of Evidence (1988), a CBS Movie of the Week, cast Kidder as a nurse who suspects that her medical pathologist husband is a serial killer.
==== Dark Messiah of Might and Magic (2006) and cancelled projects ==== Antonov joined French developer Arkane Studios. He was a level designer for their 2006 action role-playing game (RPG) Dark Messiah of Might And Magic, helping his team replicate Valve's process of making levels for Half-Life 2. Around 2007 and 2008, Arkane began developing an officially licensed Half-Life sequel, centered around the alien zombies that infest the ghost town of Ravenholm in Half-Life 2. Antonov continued helping Arkane replicate Valve's design process. The project was soon scrapped, because they did not develop it in the time that Valve wanted, and Valve was having trouble deciding where Half-Life as a series should go while making its episodic entries. Arkane's then-president Raphaël Colantonio has said that Antonov's work on the project "was pivotal to what would become Arkane later", as "he trained us in all of [Valve's] practices in terms of art, in terms of how to think of a level, [and] how to think of architecture". Antonov was a level designer for the studio's next project, an FPS titled The Crossing, for which he created a sci-fi version of Paris. In 2009, this project was also cancelled, as Arkane was unable to secure financing for it, as well as a publisher that would let them retain the game's intellectual property rights in the future. However, elements of The Crossing later came to fruition in Arkane's 2021 FPS Deathloop.
Sources: en.wikipedia.org
It is a synthetic research compound that activates REV-ERB nuclear receptors. It is not an approved drug or dietary supplement. Most information comes from cell and animal studies.
It binds REV-ERBα and REV-ERBβ and changes transcription of metabolic genes. This can affect circadian rhythm, lipid use, and mitochondrial function. The full downstream effects are still under study.
No. Some rodent studies show increased endurance, but controlled human trials are lacking. Claims about human performance are not established by published evidence.
It is a synthetic compound studied as an agonist of REV-ERB nuclear receptors. It is not an approved medicine and has mainly been examined in laboratory and animal research.